PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676772242
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family HSF
Protein Properties Length: 122aa    MW: 14029.9 Da    PI: 9.3043
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676772242genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind30.41e-091251241
                  HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTH CS
  HSF_DNA-bind  2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvL 41
                  Fl++ly+i+++++++++ sws++g+sfvv++ +e++++vL
     676772242 12 FLNRLYNIVDNPATDSIASWSQSGKSFVVWNLDELTRDVL 51
                  9************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004153.9E-1010103IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene3DG3DSA:1.10.10.101.6E-1210102IPR011991Winged helix-turn-helix DNA-binding domain
SuperFamilySSF467851.63E-1212102IPR011991Winged helix-turn-helix DNA-binding domain
PfamPF004471.8E-912102IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 122 aa     Download sequence    Send to blast
MVEIGRNIDE VFLNRLYNIV DNPATDSIAS WSQSGKSFVV WNLDELTRDV LFGVSGPLEF  60
TIPSILCICG YRFRRVGHPP RTELANDNFV RGQRQLMKNI PRPGKEPIQK QQNQKENSNQ  120
RN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006401778.15e-37hypothetical protein EUTSA_v10015077mg
TrEMBLV4NBE56e-37V4NBE5_EUTSA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM1954256
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18870.17e-18HSF family protein